-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NAT8B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 75-165 of human NAT8B (NP_057431.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against NAT8B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 75-165 of human NAT8B (NP_057431.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02630A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NAT8B |
| Target Synonyms | CML2; Hcml2; NAT8BP; NAT8B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 75-165 of human NAT8B (NP_057431.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFA | Uniprot ID | Q9UHF3 |
Uniprot Id
Q9UHF3
Target Species
Human
Target Name
NAT8B
Target Full Name
Putative N-acetyltransferase 8B
Target Function
May have a lysine N-acetyltransferase activity catalyzing peptidyl-lysine N6-acetylation of various proteins. Thereby, may regulate apoptosis through the acetylation and the regulation of the expression of PROM1. May also regulate amyloid beta-peptide secretion through acetylation of BACE1 and the regulation of its expression in neurons.
Target Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type II membrane protein. Endoplasmic reticulum membrane; Single-pass type II membrane protein. Note=Enriched in the Endoplasmic reticulum-Golgi intermediate compartment.
Target Protein Families
Camello family
Target Synonyms
NAT8B; CML2; Putative N-acetyltransferase 8B; Acetyltransferase 1; ATase1; Camello-like protein 2
Target Background
This gene is highly similar to the N-acetyltransferase 8 (NAT8) gene which encodes a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance. This gene is localized on chromosome 2 in the vicinity of the NAT8 gene and represents a human-specific transcribed pseudogene of NAT8. This gene contains two common polymorphic nonsense mutations that disrupt the active site of the protein. In the extremely rare event when both nonsense mutations are absent, the predicted protein would contain a complete acetyltransferase domain and would be identical in length to NAT8.
Notification