Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NCAM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 500-690 of human NCAM2 (NP_004531.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NCAM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 500-690 of human NCAM2 (NP_004531.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04029A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NCAM2 |
| Target Synonyms | NCAM21; NCAM2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 500-690 of human NCAM2 (NP_004531.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNI | Uniprot ID | O15394 |
Uniprot Id
O15394
Target Species
Human
Target Name
NCAM2
Target Full Name
Neural cell adhesion molecule 2
Target Function
May play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed most strongly in adult and fetal brain.
Target Synonyms
Cell adhesion molecule, neural, 2; MGC51008; N CAM 2; N CAM 21; N CAM2; N CAM21; N-CAM-2; NCAM 2; NCAM 21; NCAM-2; Ncam2; NCAM2_HUMAN; NCAM21; Neural cell adhesion molecule 2; OCAM GPI; R4B12 ; RB 8 neural cell adhesion molecule; RB8 neural cell adhesion molecule; RNCAM
Target Background
The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein and may function in selective fasciculation and zone-to-zone projection of the primary olfactory axons.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
