-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NCF4/p40-phox was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-190 of human NCF4/p40-phox (NP_038202.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NCF4/p40-phox was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-190 of human NCF4/p40-phox (NP_038202.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04410A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NCF4/p40-phox |
| Target Synonyms | NCF; CGD3; P40PHOX; SH3PXD4; NCF4/p40-phox | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, RAW264.7, U-937 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-190 of human NCF4/p40-phox (NP_038202.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELN | Uniprot ID | Q15080 |
Uniprot Id
Q15080
Target Species
Human
Target Name
NCF4
Target Full Name
Neutrophil cytosol factor 4
Target Function
Component of the NADPH-oxidase, a multicomponent enzyme system responsible for the oxidative burst in which electrons are transported from NADPH to molecular oxygen, generating reactive oxidant intermediates. It may be important for the assembly and/or activation of the NADPH-oxidase complex.
Target Involvement
Granulomatous disease, chronic, cytochrome-b-positive 3, autosomal recessive (CGD3)
Target Subcellular Location
Cytoplasm, cytosol. Endosome membrane; Peripheral membrane protein; Cytoplasmic side. Membrane; Peripheral membrane protein.
Target Tissue Specificity
Expression is restricted to hematopoietic cells.
Target Synonyms
CGD3; MGC3810; NCF 4; NCF; NCF-4; Ncf4; NCF4_HUMAN; Neutrophil cytosol factor 4; Neutrophil cytosolic factor 4; Neutrophil NADPH oxidase factor 4; p40-phox; p40phox; SH3 and PX domain-containing protein 4; SH3PXD4
Target Background
The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Notification