-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NCK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human NCK11 (P16333) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NCK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human NCK11 (P16333) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14017A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NCK1 |
| Target Synonyms | NCK; nck-1; NCKalpha; NCK1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, Mouse brain, Mouse lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human NCK11 (P16333). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG | Uniprot ID | P16333 |
Uniprot Id
P16333
Target Species
Human
Target Name
NCK1
Target Full Name
SH2/SH3 adapter protein NCK1
Target Function
Adapter protein which associates with tyrosine-phosphorylated growth factor receptors, such as KDR and PDGFRB, or their cellular substrates. Maintains low levels of EIF2S1 phosphorylation by promoting its dephosphorylation by PP1. Plays a role in the DNA damage response, not in the detection of the damage by ATM/ATR, but for efficient activation of downstream effectors, such as that of CHEK2. Plays a role in ELK1-dependent transcriptional activation in response to activated Ras signaling. Modulates the activation of EIF2AK2/PKR by dsRNA. May play a role in cell adhesion and migration through interaction with ephrin receptors.
Target Subcellular Location
Cytoplasm. Endoplasmic reticulum. Nucleus. Note=Mostly cytoplasmic, but shuttles between the cytoplasm and the nucleus. Import into the nucleus requires the interaction with SOCS7. Predominantly nuclear following genotoxic stresses, such as UV irradiation, hydroxyurea or mitomycin C treatments.
Target Synonyms
Cytoplasmic protein NCK1; Melanoma Nck protein; MGC12668; NCK 1; NCK adaptor protein 1; NCK alpha; NCK; NCK tyrosine kinase; Nck-1; NCK1; NCK1_HUMAN; NCKalpha; Non catalytic region of tyrosine kinase; SH2/SH3 adaptor protein NCK alpha; SH2/SH3 adaptor protein NCK-alpha
Target Background
The protein encoded by this gene is one of the signaling and transforming proteins containing Src homology 2 and 3 (SH2 and SH3) domains. It is located in the cytoplasm and is an adaptor protein involved in transducing signals from receptor tyrosine kinases to downstream signal recipients such as RAS. Alternatively spliced transcript variants encoding different isoforms have been found.
Notification