Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NCOA5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-380 of human NCOA5 (NP_066018.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NCOA5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-380 of human NCOA5 (NP_066018.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04113A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NCOA5 |
| Target Synonyms | CIA; bA465L10.6; NCOA5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, MCF7, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 240-380 of human NCOA5 (NP_066018.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTD | Uniprot ID | Q9HCD5 |
Uniprot Id
Q9HCD5
Target Species
Human
Target Name
NCOA5
Target Full Name
Nuclear receptor coactivator 5
Target Function
Nuclear receptor coregulator that can have both coactivator and corepressor functions. Interacts with nuclear receptors for steroids (ESR1 and ESR2) independently of the steroid binding domain (AF-2) of the ESR receptors, and with the orphan nuclear receptor NR1D2. Involved in the coactivation of nuclear steroid receptors (ER) as well as the corepression of MYC in response to 17-beta-estradiol (E2).
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Widely expressed.
Target Synonyms
NCOA5; KIAA1637; Nuclear receptor coactivator 5; NCoA-5; Coactivator independent of AF-2; CIA
Target Background
This gene encodes a coregulator for the alpha and beta estrogen receptors and the orphan nuclear receptor NR1D2. The protein localizes to the nucleus, and is thought to have both coactivator and corepressor functions. Its interaction with nuclear receptors is independent of the AF2 domain on the receptors, which is known to regulate interaction with other coreceptors. Several alternatively spliced transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
