Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NCTR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NCTR2 (O95944) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NCTR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NCTR2 (O95944) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13186A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NCTR2 |
| Target Synonyms | LY95; CD336; NKP44; NK-p44; dJ149M18.1; NCTR2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Raji, THP-1 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NCTR2 (O95944). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAWRALHPLLLLLLLFPGSQAQSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLR | Uniprot ID | O95944 |
Uniprot Id
O95944
Target Species
Human
Target Name
NCR2
Target Full Name
Natural cytotoxicity triggering receptor 2
Target Function
Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Natural cytotoxicity receptor (NCR) family
Target Tissue Specificity
Selectively expressed by activated NK cells and by in vitro cultured (i.e. activated) TCRg/d lymphoid cells.
Target Synonyms
NCR2; LY95; Natural cytotoxicity triggering receptor 2; Lymphocyte antigen 95 homolog; NK cell-activating receptor; Natural killer cell p44-related protein; NK-p44; NKp44; CD antigen CD336
Target Background
Predicted to enable signaling receptor activity. Predicted to be involved in cellular defense response and signal transduction. Predicted to be located in plasma membrane. Predicted to be integral component of plasma membrane. Predicted to be active in cell surface.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
