-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDE1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human NDE1 (NP_060138.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against NDE1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human NDE1 (NP_060138.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02677A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDE1 |
| Target Synonyms | NDE; LIS4; MHAC; NUDE; NUDE1; HOM-TES-87; NDE1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, A673, HepG2, MCF7, Mouse lung, SKOV3 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human NDE1 (NP_060138.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQL | Uniprot ID | Q9NXR1 |
Uniprot Id
Q9NXR1
Target Species
Human
Target Name
NDE1
Target Full Name
Nuclear distribution protein nudE homolog 1
Target Function
Required for centrosome duplication and formation and function of the mitotic spindle. Essential for the development of the cerebral cortex. May regulate the production of neurons by controlling the orientation of the mitotic spindle during division of cortical neuronal progenitors of the proliferative ventricular zone of the brain. Orientation of the division plane perpendicular to the layers of the cortex gives rise to two proliferative neuronal progenitors whereas parallel orientation of the division plane yields one proliferative neuronal progenitor and a post-mitotic neuron. A premature shift towards a neuronal fate within the progenitor population may result in an overall reduction in the final number of neurons and an increase in the number of neurons in the deeper layers of the cortex.
Target Involvement
Lissencephaly 4 (LIS4); Microhydranencephaly (MHAC)
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Chromosome, centromere, kinetochore. Cytoplasm, cytoskeleton, spindle. Cleavage furrow. Note=Localizes to the interphase and S phase centrosome. During mitosis, partially associated with the mitotic spindle. Concentrates at the plus ends of microtubules coincident with kinetochores in metaphase and anaphase in a CENPF-dependent manner. Also localizes to the cleavage furrow during cytokinesis. manner. Also localizes to the cleavage furrow during cytokinesis.
Target Protein Families
NudE family
Target Tissue Specificity
Expressed in the neuroepithelium throughout the developing brain, including the cerebral cortex and cerebellum.
Target Research Area
Cell Biology
Target Synonyms
FLJ20101; HOM TES 87; LIS1 interacting protein NUDE1 rat homolog; LIS1 interacting protein NUDE1; LIS4; NDE 1; NDE1; NDE1_HUMAN; Nuclear distribution gene E homolog 1; Nuclear distribution protein nudE homolog 1; NUDE 1; NudE; NudE nuclear distribution gene E homolog 1 (A. nidulans) ; NudE nuclear distribution gene E homolog 1; NUDE1
Target Background
This gene encodes a member of the nuclear distribution E (NudE) family of proteins. The encoded protein is localized at the centrosome and interacts with other centrosome components as part of a multiprotein complex that regulates dynein function. This protein plays an essential role in microtubule organization, mitosis and neuronal migration. Mutations in this gene cause lissencephaly 4, a disorder characterized by lissencephaly, severe brain atrophy, microcephaly, and severe cognitive disability. Alternative splicing results in multiple transcript variants.
Notification