-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDRG1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 295-394 of human NDRG1 (Q92597) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against NDRG1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 295-394 of human NDRG1 (Q92597) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13824A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDRG1 |
| Target Synonyms | GC4; RTP; DRG1; NDR1; NMSL; TDD5; CAP43; CMT4D; DRG-1; HMSNL; RIT42; TARG1; PROXY1; NDRG1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain, PC-3 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 295-394 of human NDRG1 (Q92597). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC | Uniprot ID | Q92597 |
Uniprot Id
Q92597
Target Species
Human
Target Name
NDRG1
Target Full Name
Protein NDRG1
Target Function
Stress-responsive protein involved in hormone responses, cell growth, and differentiation. Acts as a tumor suppressor in many cell types. Necessary but not sufficient for p53/TP53-mediated caspase activation and apoptosis. Has a role in cell trafficking, notably of the Schwann cell, and is necessary for the maintenance and development of the peripheral nerve myelin sheath. Required for vesicular recycling of CDH1 and TF. May also function in lipid trafficking. Protects cells from spindle disruption damage. Functions in p53/TP53-dependent mitotic spindle checkpoint. Regulates microtubule dynamics and maintains euploidy.
Target Involvement
Charcot-Marie-Tooth disease 4D (CMT4D)
Target Subcellular Location
Cytoplasm, cytosol. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus. Cell membrane. Note=Mainly cytoplasmic but differentially localized to other regions. Associates with the plasma membrane in intestinal epithelia and lactating mammary gland. Translocated to the nucleus in a p53/TP53-dependent manner. In prostate epithelium and placental chorion, located in both the cytoplasm and in the nucleus. No nuclear localization in colon epithelium cells. In intestinal mucosa, prostate and renal cortex, located predominantly adjacent to adherens junctions. Cytoplasmic with granular staining in proximal tubular cells of the kidney and salivary gland ducts. Recruits to the membrane of recycling/sorting and late endosomes via binding to phosphatidylinositol 4-phosphate. Associates with microtubules. Colocalizes with TUBG1 in the centrosome. Cytoplasmic location increased with hypoxia. Phosphorylated form found associated with centromeres during S-phase of mitosis and with the plasma membrane.
Target Protein Families
NDRG family
Target Tissue Specificity
Ubiquitous; expressed most prominently in placental membranes and prostate, kidney, small intestine, and ovary tissues. Also expressed in heart, brain, skeletal muscle, lung, liver and pancreas. Low levels in peripheral blood leukocytes and in tissues of
Target Synonyms
42 kDa; Anti GC4; cap43; cmt4d; Differentiation related gene1 protein; Differentiation-related gene 1 protein; Drg 1; DRG-1; drg1; gc4; GC4; hmsnl; Human mRNA for RTP complete cds; N myc downstream regulated gene 1; N myc downstream regulated gene 1 protein; N-myc downstream-regulated gene 1 protein; Ndr 1; ndr1; NDRG 1; Ndrg1; NDRG1 protein ; NDRG1_HUMAN; Nickel specific induction protein; Nickel specific induction protein Cap43; Nickel-specific induction protein Cap43; nmsl; Nmyc downstream regulated; Nmyc downstream regulated gene1; Nmyc downstream regulated gene1 protein; Protein NDRG1; Protein regulated by oxygen 1; Protein regulated by oxygen1; Proxy1; Reduced in tumor; Reducin; Reducing agents and tunicamycin responsive protein ; Reducing agents and tunicamycin-responsive protein; Rit42; RTP; targ1; TDD5; tdds; Tunicamycin responsive protein
Target Background
This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. The encoded protein is necessary for p53-mediated caspase activation and apoptosis. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4D, and expression of this gene may be a prognostic indicator for several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification