-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFA12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human NDUFA12 (NP_061326.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NDUFA12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human NDUFA12 (NP_061326.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01576A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFA12 |
| Target Synonyms | B17.2; DAP13; MC1DN23; NDUFA12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat brain, Rat heart, 293T, HepG2, Mouse testis, PC-12 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human NDUFA12 (NP_061326.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK | Uniprot ID | Q9UI09 |
Uniprot Id
Q9UI09
Target Species
Human
Target Name
NDUFA12
Target Full Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Involvement
Leigh syndrome (LS)
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Target Protein Families
Complex I NDUFA12 subunit family
Target Research Area
Signal Transduction
Target Synonyms
13 kDa differentiation associated protein ; 13 kDa differentiation-associated protein; 2410011G03Rik; AW112974; B17.2; CI-B17.2; CIB17.2; Complex I B17.2; Complex I B17.2 subunit; Complex I-B17.2; DAP13; MGC107642; MGC7999; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 12; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12; NADH ubiquinone oxidoreductase subunit B17.2; NADH-ubiquinone oxidoreductase subunit B17.2; NDUAC_HUMAN; NDUFA12; RGD1311462
Target Background
This gene encodes a protein which is part of mitochondrial complex 1, part of the oxidative phosphorylation system in mitochondria. Complex 1 transfers electrons to ubiquinone from NADH which establishes a proton gradient for the generation of ATP. Mutations in this gene are associated with Leigh syndrome due to mitochondrial complex 1 deficiency. Pseudogenes of this gene are located on chromosomes 5 and 13. Alternative splicing results in multiple transcript variants.
Notification