-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFA5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human NDUFA5 (NP_004991.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NDUFA5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human NDUFA5 (NP_004991.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-00128A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFA5 |
| Target Synonyms | B13; NUFM; UQOR13; CI-13kB; CI-13KD-B; NDUFA5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, NCI-H460 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human NDUFA5 (NP_004991.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI | Uniprot ID | Q16718 |
Uniprot Id
Q16718
Target Species
Human
Target Name
NDUFA5
Target Full Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Target Protein Families
Complex I NDUFA5 subunit family
Target Tissue Specificity
Expressed in all tissues examined with highest levels in heart, skeletal muscle and brain.
Target Synonyms
B13; CI 13kB; CI-13kD-B; Complex I subunit B13; Complex I-13kD-B; DKFZp781K1356; FLJ12147; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5 (13kD, B13); NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5; NADH-ubiquinone oxidoreductase 13 kDa-B subunit; NDUA5_HUMAN; NDUFA5; NUFM; Type I dehydrogenase; Ubiquinone reductase; UQOR13
Target Background
This nuclear gene encodes a conserved protein that comprises the B13 subunit of complex I of the mitochondrial respiratory chain. The encoded protein localizes to the inner mitochondrial membrane, where it is thought to aid in the transfer of electrons from NADH to ubiquinone. Alternative splicing results in multiple transcript variants. There are numerous pseudogenes of this gene on chromosomes 1, 3, 6, 8, 9, 11, 12, and 16.
Notification