-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFAF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NDUFAF1 (Q9Y375) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NDUFAF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NDUFAF1 (Q9Y375) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14316A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFAF1 |
| Target Synonyms | CGI65; CIA30; CGI-65; MC1DN11; NDUFAF1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, U2OS | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NDUFAF1 (Q9Y375). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALVHKLLRGTYFLRKFSKPTSALYPFLGIRFAEYSSSLQKPVASPGKASSQRKTEGDLQGDHQKEVALDITSSEEKPDVSFDKAIRDEAIYHFRLLKDEIVDHWRGPEGHPLHEVLLEQAKVVWQFRGKEDLDKWTVTSDKTIGGRSEV | Uniprot ID | Q9Y375 |
Uniprot Id
Q9Y375
Target Species
Human
Target Name
NDUFAF1
Target Full Name
Complex I intermediate-associated protein 30, mitochondrial
Target Function
Chaperone protein involved in early stages of the assembly of mitochondrial NADH:ubiquinone oxidoreductase complex (complex I).
Target Subcellular Location
Mitochondrion. Mitochondrion matrix.
Target Protein Families
CIA30 family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
CGI 65; CGI65; CIA30; CIA30_HUMAN; Complex I intermediate associated protein 30; Complex I intermediate associated protein 30 mitochondrial; Complex I intermediate-associated protein 30; mitochondrial; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex assembly factor 1; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 1; NADH:ubiquinone oxidoreductase complex assembly factor 1; NDUFAF 1; Ndufaf1
Target Background
This gene encodes a complex I assembly factor protein. Complex I (NADH-ubiquinone oxidoreductase) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. The encoded protein is required for assembly of complex I, and mutations in this gene are a cause of mitochondrial complex I deficiency. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 19.
Notification