Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human NDUFB1 (NP_004536.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NDUFB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human NDUFB1 (NP_004536.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04104A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFB1 |
| Target Synonyms | MNLL; CI-MNLL; CI-SGDH; NDUFB1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A375, Mouse brain, Mouse pancreas | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human NDUFB1 (NP_004536.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MICWRHPSAPCGRGEWQVPRSQLPLARVEFPVALGLGVAVGAEAAAIMVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK | Uniprot ID | O75438 |
Uniprot Id
O75438
Target Species
Human
Target Name
NDUFB1
Target Full Name
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.
Target Protein Families
Complex I NDUFB1 subunit family
Target Synonyms
CI-MNLL; CI-SGDH; complex I MNLL subunit; Complex I-MNLL; MNLL; NADH dehydrogenase (ubiquinone) 1 beta subcomplex; 1; 7kDa; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1; NADH-ubiquinone oxidoreductase 1 beta subcomplex; 1; NADH-ubiquinone oxidoreductase MNLL subunit; NADH:ubiquinone oxidoreductase subunit B1; NDUB1_HUMAN; NDUFB1
Target Background
Involved in mitochondrial respiratory chain complex I assembly. Located in mitochondrion and nuclear speck. Part of mitochondrial respiratory chain complex I.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
