Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFB10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human NDUFB10 (NP_004539.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against NDUFB10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human NDUFB10 (NP_004539.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-10718A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFB10 |
| Target Synonyms | PDSW; MC1DN35; NDUFB10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, HepG2, Jurkat, MCF-7, Mouse brain | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human NDUFB10 (NP_004539.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS | Uniprot ID | O96000 |
Uniprot Id
O96000
Target Species
Human
Target Name
NDUFB10
Target Full Name
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
Target Function
Accessory subunit that is involved in the functional assembly of the mitochondrial respiratory chain complex I. Complex I has an NADH dehydrogenase activity with ubiquinone as an immediate electron acceptor and mediates the transfer of electrons from NADH to the respiratory chain.
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Target Protein Families
Complex I NDUFB10 subunit family
Target Research Area
others
Target Synonyms
0610011B04Rik; 22kDa; CI PDSW; CI-PDSW; Complex I PDSW; Complex I PDSW subunit; Complex I-PDSW; NADH dehydrogenase (ubiquinone) 1 beta subcomplex 10 22kDa; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10; NADH ubiquinone oxidoreductase PDSW subunit; NADH-ubiquinone oxidoreductase PDSW subunit; NDUBA_HUMAN; NDUFB 10; Ndufb10; PDSW
Target Background
Involved in mitochondrial respiratory chain complex I assembly. Located in mitochondrial inner membrane. Part of mitochondrial respiratory chain complex I. Implicated in nuclear type mitochondrial complex I deficiency 35.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
