Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFB11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human NDUFB11 (NP_061929.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NDUFB11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human NDUFB11 (NP_061929.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11373A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFB11 |
| Target Synonyms | ESSS; Np15; P17.3; NP17.3; CI-ESSS; MC1DN30; NDUFB11 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat brain, HepG2, K-562, Mouse liver, Rat liver, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human NDUFB11 (NP_061929.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRCTGCPRAWDGMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE | Uniprot ID | Q9NX14 |
Uniprot Id
Q9NX14
Target Species
Human
Target Name
NDUFB11
Target Full Name
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Involvement
Linear skin defects with multiple congenital anomalies 3 (LSDMCA3); Mitochondrial complex I deficiency (MT-C1D)
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Target Protein Families
Complex I NDUFB11 subunit family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
NDUFB11; UNQ111/PRO1064; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial; Complex I-ESSS; CI-ESSS; NADH-ubiquinone oxidoreductase ESSS subunit; Neuronal protein 17.3; Np17.3; p17.3
Target Background
The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to ubiquinone. Mutations in the human gene are associated with linear skin defects with multiple congenital anomalies 3 and mitochondrial complex I deficiency.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
