-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFB5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-189 of human NDUFB5 (NP_002483.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NDUFB5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-189 of human NDUFB5 (NP_002483.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07862A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFB5 |
| Target Synonyms | SGDH; CISGDH; NDUFB5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-189 of human NDUFB5 (NP_002483.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN | Uniprot ID | O43674 |
Uniprot Id
O43674
Target Species
Human
Target Name
NDUFB5
Target Full Name
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.
Target Protein Families
Complex I NDUFB5 subunit family
Target Research Area
Cancer
Target Synonyms
CI SGDH; CI-SGDH; Complex I SGDH; Complex I-SGDH; DKFZp686N02262; FLJ30597; MGC111204; MGC12314; mitochondrial; NADH dehydrogenase (ubiquinone) 1 beta subcomplex 5 ; NADH dehydrogenase (ubiquinone) 1 beta subcomplex 5 16kDa; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5 mitochondrial; NADH ubiquinone oxidoreductase SGDH subunit; NADH-ubiquinone oxidoreductase SGDH subunit; NDUB5_HUMAN; Ndufb5; SGDH
Target Background
The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Three transcript variants encoding different isoforms have been found for this gene.
Notification