Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFB7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human NDUFB7 (NP_004137.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NDUFB7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human NDUFB7 (NP_004137.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-06109A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFB7 |
| Target Synonyms | B18; CI-B18; MC1DN39; NDUFB7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, A-431, HL-60, MCF7, Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human NDUFB7 (NP_004137.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL | Uniprot ID | P17568 |
Uniprot Id
P17568
Target Species
Human
Target Name
NDUFB7
Target Full Name
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein. Mitochondrion intermembrane space.
Target Protein Families
Complex I NDUFB7 subunit family
Target Research Area
Transport
Target Synonyms
1110002H15Rik; B18; Cell adhesion protein SQM1; CI B18; CI-B18; Complex I B18; Complex I B18 subunit; Complex I-B18; MGC2480; NADH dehydrogenase (ubiquinone) 1 beta subcomplex 7 18kDa; NADH dehydrogenase (ubiquinone) 1 beta subcomplex 7; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7; NADH ubiquinone oxidoreductase B18 subunit; NADH-ubiquinone oxidoreductase 1 beta subcomplex; 7; NADH-ubiquinone oxidoreductase B18 subunit; NDUB7_HUMAN; Ndufb7
Target Background
The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
