Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NDUFC2 (NP_004540.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NDUFC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NDUFC2 (NP_004540.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16730A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFC2 |
| Target Synonyms | HLC-1; B14.5b; MC1DN36; NADHDH2; CI-B14.5b; C2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, 293T, A-549, Mouse brain, Mouse stomach, OVCAR3, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NDUFC2 (NP_004540.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDF | Uniprot ID | O95298 |
Uniprot Id
O95298
Target Species
Human
Target Name
NDUFC2
Target Full Name
NADH dehydrogenase [ubiquinone] 1 subunit C2
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.
Target Protein Families
Complex I NDUFC2 subunit family
Target Synonyms
NDUFC2; HLC1; NADH dehydrogenase [ubiquinone] 1 subunit C2; Complex I-B14.5b; CI-B14.5b; Human lung cancer oncogene 1 protein; HLC-1; NADH-ubiquinone oxidoreductase subunit B14.5b
Target Background
Involved in mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Part of mitochondrial respiratory chain complex I. Implicated in nuclear type mitochondrial complex I deficiency.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
