-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFS3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 165-264 of human NDUFS3 (O75489) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against NDUFS3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 165-264 of human NDUFS3 (O75489) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13881A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFS3 |
| Target Synonyms | CI-30; MC1DN8; NDUFS3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, HepG2, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 165-264 of human NDUFS3 (O75489). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK | Uniprot ID | O75489 |
Uniprot Id
O75489
Target Species
Human
Target Name
NDUFS3
Target Full Name
NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
Target Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity and assembly of complex I.
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Target Protein Families
Complex I 30 kDa subunit family
Target Synonyms
CI 30; CI 30KD; CI-30kD; Complex I 30KD; Complex I 30kDa subunit; COMPLEX I, MITOCHONDRIAL RESPIRATORY CHAIN, 30-KD SUBUNIT; Complex I-30kD; mitochondrial; NADH coenzyme Q reductase; NADH dehydrogenase (ubiquinone) Fe S protein 3 30kDa; NADH dehydrogenase [ubiquinone] iron sulfur protein 3 mitochondrial; NADH dehydrogenase [ubiquinone] iron-sulfur protein 3; NADH dehydrogenase ubiquinone 30 kDa subunit ; NADH-ubiquinone oxidoreductase 30 kDa subunit; NADH-Ubiquinone Oxidoreductase Fe-S Protein 3; NDUFS3; NDUS3_HUMAN
Target Background
This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.
Notification