Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFS5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human NDUFS5 (NP_004543.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NDUFS5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human NDUFS5 (NP_004543.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Western blot analysis of various lysates, using NDUFS5 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
| Cat.No | ADA-07642A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFS5 |
| Target Synonyms | CI15K; CI-15k; [KD Validated] NDUFS5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat brain, 293T, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human NDUFS5 (NP_004543.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP | Uniprot ID | O43920 |
Uniprot Id
O43920
Target Species
Human
Target Name
NDUFS5
Target Full Name
NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein. Mitochondrion intermembrane space.
Target Protein Families
Complex I NDUFS5 subunit family
Target Research Area
Transport
Target Synonyms
CI 15k; CI-15 kDa; CI15K; Complex I-15 kDa; NADH dehydrogenase (ubiquinone) Fe S protein 5, 15kDa (NADH coenzyme Q reductase); NADH dehydrogenase [ubiquinone] iron-sulfur protein 5; NADH-ubiquinone oxidoreductase 15 kDa subunit; NADH:ubiquinone oxidoreductase 15 kDa IP subunit; NDUFS5; NDUS5_HUMAN
Target Background
This gene is a member of the NADH dehydrogenase (ubiquinone) iron-sulfur protein family. The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. Alternative splicing results in multiple transcript variants and pseudogenes have been identified on chromosomes 1, 4 and 17.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
