-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Nectin-4/PVRL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 32-146 of human Nectin-4/PVRL4 (NP_112178.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.
The antibody against Nectin-4/PVRL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 32-146 of human Nectin-4/PVRL4 (NP_112178.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.
| Cat.No | ADA-15717A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Nectin-4/PVRL4 |
| Target Synonyms | LNIR; PRR4; EDSS1; PVRL4; nectin-4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, FC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 32-146 of human Nectin-4/PVRL4 (NP_112178.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVL | Uniprot ID | Q96NY8 |
Uniprot Id
Q96NY8
Target Species
Human
Target Name
NECTIN4
Target Full Name
Nectin-4
Target Function
Seems to be involved in cell adhesion through trans-homophilic and -heterophilic interactions, the latter including specifically interactions with NECTIN1. Does not act as receptor for alpha-herpesvirus entry into cells.; (Microbial infection) Acts as a receptor for measles virus.
Target Involvement
Ectodermal dysplasia-syndactyly syndrome 1 (EDSS1)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction, adherens junction. Note=Colocalizes with AFDN at cadherin-based adherens junctions (PubMed:11544254).; [Processed poliovirus receptor-related protein 4]: Secreted. Note=The secreted form is found in breast tumor patients (PubMed:15784625).
Target Protein Families
Nectin family
Target Tissue Specificity
Predominantly expressed in placenta. Not detected in normal breast epithelium but expressed in breast carcinoma.
Target Research Area
Cell Adhesion
Target Synonyms
DKFZp686K05193; EDSS1; Ig superfamily receptor LNIR; Nectin 4; Nectin-4; poliovirus receptor-related 4; Processed poliovirus receptor-related protein 4; PRR4 ; pvrl4; PVRL4_HUMAN
Target Background
This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.
Notification