-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NEDD4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human NEDD4 (P46934) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NEDD4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human NEDD4 (P46934) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16593A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NEDD4 |
| Target Synonyms | RPF1; NEDD4-1; NEDD4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human NEDD4 (P46934). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEE | Uniprot ID | P46934 |
Uniprot Id
P46934
Target Species
Human
Target Name
NEDD4
Target Full Name
E3 ubiquitin-protein ligase NEDD4
Target Function
E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Specifically ubiquitinates 'Lys-63' in target proteins. Involved in the pathway leading to the degradation of VEGFR-2/KDFR, independently of its ubiquitin-ligase activity. Monoubiquitinates IGF1R at multiple sites, thus leading to receptor internalization and degradation in lysosomes. Ubiquitinates FGFR1, leading to receptor internalization and degradation in lysosomes. Promotes ubiquitination of RAPGEF2. According to PubMed:18562292 the direct link between NEDD4 and PTEN regulation through polyubiquitination described in PubMed:17218260 is questionable. Involved in ubiquitination of ERBB4 intracellular domain E4ICD. Involved in the budding of many viruses. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. Ubiquitinates TNK2 and regulates EGF-induced degradation of EGFR and TNF2. Ubiquitinates BRAT1 and this ubiquitination is enhanced in the presence of NDFIP1.; (Microbial infection) Involved in the ubiquitination of Ebola virus protein VP40 which plays a role in viral budding.
Target Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein.
Target Synonyms
Cell proliferation-inducing gene 53 protein; E3 ubiquitin protein ligase Nedd4; E3 ubiquitin-protein ligase NEDD4; HECT-type E3 ubiquitin transferase NEDD4; KIAA0093; NEDD 4; NEDD-4; Nedd4; NEDD4_HUMAN; Neural precursor cell expressed developmentally down regulated 4; Neural precursor cell expressed developmentally down-regulated protein 4; neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase; PIG53; receptor-potentiating factor 1; RPF1
Target Background
This gene is the founding member of the NEDD4 family of HECT ubiquitin ligases that function in the ubiquitin proteasome system of protein degradation. The encoded protein contains an N-terminal calcium and phospholipid binding C2 domain followed by multiple tryptophan-rich WW domains and, a C-terminal HECT ubiquitin ligase catalytic domain. It plays critical role in the regulation of a number of membrane receptors, endocytic machinery components and the tumor suppressor PTEN.
Notification