-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NEDD9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 390-560 of human NEDD9 (NP_006394.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NEDD9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 390-560 of human NEDD9 (NP_006394.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-04339A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NEDD9 |
| Target Synonyms | CAS2; CASL; HEF1; CAS-L; CASS2; NEDD9 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 390-560 of human NEDD9 (NP_006394.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSLSASPAQDKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELILHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPDDAKQLTTTINTNAEALFRPG | Uniprot ID | Q14511 |
Uniprot Id
Q14511
Target Species
Human
Target Name
NEDD9
Target Full Name
Enhancer of filamentation 1
Target Function
Docking protein which plays a central coordinating role for tyrosine-kinase-based signaling related to cell adhesion. May function in transmitting growth control signals between focal adhesions at the cell periphery and the mitotic spindle in response to adhesion or growth factor signals initiating cell proliferation. May play an important role in integrin beta-1 or B cell antigen receptor (BCR) mediated signaling in B- and T-cells. Integrin beta-1 stimulation leads to recruitment of various proteins including CRK, NCK and SHPTP2 to the tyrosine phosphorylated form. Required for correct adhesion and migration of T-cells.
Target Subcellular Location
Cytoplasm, cell cortex. Nucleus. Golgi apparatus. Cell projection, lamellipodium. Cytoplasm. Cell junction, focal adhesion. Note=Localizes to both the cell nucleus and the cell periphery and is differently localized in fibroblasts and epithelial cells. In fibroblasts is predominantly nuclear and in some cells is present in the Golgi apparatus. In epithelial cells localized predominantly in the cell periphery with particular concentration in lamellipodia but is also found in the nucleus. Isoforms p105 and p115 are predominantly cytoplasmic and associate with focal adhesions while p55 associates with mitotic spindle.; [Enhancer of filamentation 1 p55]: Cytoplasm, cytoskeleton, spindle.
Target Protein Families
CAS family
Target Tissue Specificity
Widely expressed. Higher levels detected in kidney, lung, and placenta. Also detected in T-cells, B-cells and diverse cell lines. The protein has been detected in lymphocytes, in diverse cell lines, and in lung tissues.
Target Synonyms
Cas like docking; Cas scaffolding protein family member 2; CAS-L; CAS2; CasL; CASL_HUMAN; CASS2; Crk associated substrate related; Crk associated substrate related protein; CRK-associated substrate-related protein; dJ49G10.2 (Enhancer of Filamentation 1 (HEF1)); dJ49G10.2; dJ761I2.1 (enhancer of filamentation (HEF1)); dJ761I2.1; Enhancer of filamentation 1; Enhancer of filamentation 1 p55; HEF 1; HEF1; NEDD-9; Nedd9; Neural precursor cell expressed developmentally down-regulated protein 9; P105; Renal carcinoma antigen NY-REN-12
Target Background
The protein encoded by this gene is a member of the CRK-associated substrates family. Members of this family are adhesion docking molecules that mediate protein-protein interactions for signal transduction pathways. This protein is a focal adhesion protein that acts as a scaffold to regulate signaling complexes important in cell attachment, migration and invasion as well as apoptosis and the cell cycle. This protein has also been reported to have a role in cancer metastasis. Alternative splicing results in multiple transcript variants.
Notification