-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NEIL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human NEIL1 (NP_078884.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NEIL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human NEIL1 (NP_078884.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03654A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NEIL1 |
| Target Synonyms | FPG1; NEI1; hFPG1; NEIL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, MCF7, Mouse spleen, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human NEIL1 (NP_078884.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLILSPLPGAQPQQEPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGP | Uniprot ID | Q96FI4 |
Uniprot Id
Q96FI4
Target Species
Human
Target Name
NEIL1
Target Full Name
Endonuclease 8-like 1
Target Function
Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized pyrimidines, such as thymine glycol, formamidopyrimidine (Fapy) and 5-hydroxyuracil. Has marginal activity towards 8-oxoguanine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Has DNA glycosylase/lyase activity towards mismatched uracil and thymine, in particular in U:C and T:C mismatches. Specifically binds 5-hydroxymethylcytosine (5hmC), suggesting that it acts as a specific reader of 5hmC.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus. Chromosome. Note=During mitosis, associates with centrosomes and condensed chromatin.
Target Protein Families
FPG family
Target Tissue Specificity
Ubiquitous.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
DNA (apurinic or apyrimidinic site) lyase Neil1; DNA glycosylase/AP lyase Neil 1; DNA glycosylase/AP lyase Neil1; DNA-(apurinic or apyrimidinic site) lyase Neil1; Endonuclease 8 like 1; Endonuclease 8-like 1; Endonuclease VIII; Endonuclease VIII like 1; Endonuclease VIII-like 1; FLJ22402; FPG1; hFPG1; NEH 1; NEH1; NEI 1; Nei endonuclease VIII like 1 (E. coli); Nei endonuclease VIII like 1; Nei homolog 1; Nei like 1; Nei like protein 1; Nei-like protein 1; NEI1; NEIL 1; Neil1; NEIL1_HUMAN
Target Background
This gene is a member of the Nei endonuclease VIII-like gene family which encodes DNA glycosylases. The encoded enzyme participates in the DNA repair pathway by initiating base excision repair by removing damaged bases, primarily oxidized pyrimidines. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification