-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NEK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human NEK2 (NP_001191112.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NEK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human NEK2 (NP_001191112.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03817A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NEK2 |
| Target Synonyms | NLK1; RP67; NEK2A; HsPK21; PPP1R111; NEK2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human NEK2 (NP_001191112.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGH | Uniprot ID | P51955 |
Uniprot Id
P51955
Target Species
Human
Target Name
NEK2
Target Full Name
Serine/threonine-protein kinase Nek2
Target Function
Protein kinase which is involved in the control of centrosome separation and bipolar spindle formation in mitotic cells and chromatin condensation in meiotic cells. Regulates centrosome separation (essential for the formation of bipolar spindles and high-fidelity chromosome separation) by phosphorylating centrosomal proteins such as CROCC, CEP250 and NINL, resulting in their displacement from the centrosomes. Regulates kinetochore microtubule attachment stability in mitosis via phosphorylation of NDC80. Involved in regulation of mitotic checkpoint protein complex via phosphorylation of CDC20 and MAD2L1. Plays an active role in chromatin condensation during the first meiotic division through phosphorylation of HMGA2. Phosphorylates: PPP1CC; SGO1; NECAB3 and NPM1. Essential for localization of MAD2L1 to kinetochore and MAPK1 and NPM1 to the centrosome. Phosphorylates CEP68 and CNTLN directly or indirectly. NEK2-mediated phosphorylation of CEP68 promotes CEP68 dissociation from the centrosome and its degradation at the onset of mitosis. Involved in the regulation of centrosome disjunction.; Phosphorylates and activates NEK11 in G1/S-arrested cells.; Not present in the nucleolus and, in contrast to isoform 1, does not phosphorylate and activate NEK11 in G1/S-arrested cells.
Target Involvement
Retinitis pigmentosa 67 (RP67)
Target Subcellular Location
[Isoform 1]: Nucleus. Nucleus, nucleolus. Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle pole. Chromosome, centromere, kinetochore. Chromosome, centromere. Note=STK3/MST2 and SAV1 are required for its targeting to the centrosome. Colocalizes with SGO1 and MAD1L1 at the kinetochore. Not associated with kinetochore in the interphase but becomes associated with it upon the breakdown of the nuclear envelope. Has a nucleolar targeting/ retention activity via a coiled-coil domain at the C-terminal end.; [Isoform 2]: Cytoplasm. Note=Predominantly cytoplasmic.; [Isoform 4]: Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Note=Predominantly nuclear.
Target Protein Families
Protein kinase superfamily, NEK Ser/Thr protein kinase family, NIMA subfamily
Target Tissue Specificity
Isoform 1 and isoform 2 are expressed in peripheral blood T-cells and a wide variety of transformed cell types. Isoform 1 and isoform 4 are expressed in the testis. Up-regulated in various cancer cell lines, as well as primary breast tumors.
Target Synonyms
HSPK 21; HsPK21; NEK 2; NEK2; NEK2_HUMAN; NEK2A; Never in mitosis A-related kinase 2; NIMA (never in mitosis gene a) related kinase 2; NimA like protein kinase 1; NIMA related kinase 2; NimA related protein kinase 2; NimA-like protein kinase 1; NimA-related protein kinase 2; NLK 1; NLK1; Serine/threonine-protein kinase Nek2
Target Background
This gene encodes a serine/threonine-protein kinase that is involved in mitotic regulation. This protein is localized to the centrosome, and undetectable during G1 phase, but accumulates progressively throughout the S phase, reaching maximal levels in late G2 phase. Alternatively spliced transcript variants encoding different isoforms with distinct C-termini have been noted for this gene.
Notification