-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NEK6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human NEK6 (Q9HC98) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against NEK6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human NEK6 (Q9HC98) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14148A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NEK6 |
| Target Synonyms | SID6-1512; NEK6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, K-562, Mouse brain, Mouse lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human NEK6 (Q9HC98). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVH | Uniprot ID | Q9HC98 |
Uniprot Id
Q9HC98
Target Species
Human
Target Name
NEK6
Target Full Name
Serine/threonine-protein kinase Nek6
Target Function
Protein kinase which plays an important role in mitotic cell cycle progression. Required for chromosome segregation at metaphase-anaphase transition, robust mitotic spindle formation and cytokinesis. Phosphorylates ATF4, CIR1, PTN, RAD26L, RBBP6, RPS7, RPS6KB1, TRIP4, STAT3 and histones H1 and H3. Phosphorylates KIF11 to promote mitotic spindle formation. Involved in G2/M phase cell cycle arrest induced by DNA damage. Inhibition of activity results in apoptosis. May contribute to tumorigenesis by suppressing p53/TP53-induced cancer cell senescence. Phosphorylates EML4 at 'Ser-144', promoting its dissociation from microtubules during mitosis which is required for efficient chromosome congression.
Target Subcellular Location
Cytoplasm. Nucleus. Nucleus speckle. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle pole. Note=Colocalizes with APBB1 at the nuclear speckles. Colocalizes with PIN1 in the nucleus. Colocalizes with ATF4, CIR1, ARHGAP33, ANKRA2, CDC42, NEK9, RAD26L, RBBP6, RPS7, TRIP4, RELB and PHF1 in the centrosome. Localizes to spindle microtubules in metaphase and anaphase and to the midbody during cytokinesis.
Target Protein Families
Protein kinase superfamily, NEK Ser/Thr protein kinase family, NIMA subfamily
Target Tissue Specificity
Ubiquitous, with highest expression in heart and skeletal muscle.
Target Synonyms
Highly similar to cell cycle protein kinase CDC5/MSD2; NEK6; NEK6_HUMAN; Never in mitosis A-related kinase 6; NIMA (Never In Mitosis Gene A) Related Kinase 6; NimA related protein kinase 6; NimA-related protein kinase 6; Protein kinase SID6 1512; Protein kinase SID6-1512; Putative serine threonine protein kinase; Serine/threonine protein kinase Nek6; Serine/threonine-protein kinase Nek6; SID6 1512; SID61512
Target Background
The protein encoded by this gene is a kinase required for progression through the metaphase portion of mitosis. Inhibition of the encoded protein can lead to apoptosis. This protein also can enhance tumorigenesis by suppressing tumor cell senescence. Several transcript variants encoding a few different isoforms have been found for this gene.
Notification