-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NEK8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-390 of human NEK8 (NP_835464.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NEK8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-390 of human NEK8 (NP_835464.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10369A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NEK8 |
| Target Synonyms | JCK; NPHP9; RHPD2; NEK12A; NEK8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, MCF7, Mouse liver, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 270-390 of human NEK8 (NP_835464.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GSVRMRRAEKSVAPSNTGSRTTSVRCRGIPRGPVRPAIPPPLSSVYAWGGGLGTPLRLPMLNTEVVQVAAGRTQKAGVTRSGRLILWEAPPLGAGGGSLLPGAVEQPQPQFISRFLEGQSG | Uniprot ID | Q86SG6 |
Uniprot Id
Q86SG6
Target Species
Human
Target Name
NEK8
Target Full Name
Serine/threonine-protein kinase Nek8
Target Function
Required for renal tubular integrity. May regulate local cytoskeletal structure in kidney tubule epithelial cells. May regulate ciliary biogenesis through targeting of proteins to the cilia. Plays a role in organogenesis and is involved in the regulation of the Hippo signaling pathway.
Target Involvement
Nephronophthisis 9 (NPHP9); Renal-hepatic-pancreatic dysplasia 2 (RHPD2)
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Cell projection, cilium. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
Protein kinase superfamily, NEK Ser/Thr protein kinase family, NIMA subfamily
Target Tissue Specificity
Highest expression in thyroid, adrenal gland and skin. Low levels in spleen, colon and uterus. Overexpressed in breast tumors, with highest expression in infiltrating ductal carcinomas and moderate levels in mucinous adenocarcinoma.
Target Synonyms
JCK; NEK 8; NEK12A; NEK8; NEK8_HUMAN; Nephrocystin 9; Never in mitosis A-related kinase 8; NIMA (never in mitosis gene a) related kinase 8; NIMA related kinase 8; NIMA-family kinase NEK8; NIMA-related kinase 12a ; Nima-related protein kinase 12a; NimA-related protein kinase 8; NPHP9; Serine/threonine-protein kinase Nek8
Target Background
This gene encodes a member of the serine/threionine protein kinase family related to NIMA (never in mitosis, gene A) of Aspergillus nidulans. The encoded protein may play a role in cell cycle progression from G2 to M phase. Mutations in the related mouse gene are associated with a disease phenotype that closely parallels the juvenile autosomal recessive form of polycystic kidney disease in humans.
Notification