Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NEUROG3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 144-214 of human NEUROG3 (NP_066279.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NEUROG3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 144-214 of human NEUROG3 (NP_066279.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07745A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NEUROG3 |
| Target Synonyms | ngn3; Atoh5; NGN-3; Math4B; bHLHa7; NEUROG3 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse large intestine, Mouse pancreas, Mouse small intestine | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 144-214 of human NEUROG3 (NP_066279.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HSLYALEPPAPHCGELGSPGGSPGDWGSLYSPVSQAGSLSPAASLEERPGLLGATFSACLSPGSLAFSDFL | Uniprot ID | Q9Y4Z2 |
Uniprot Id
Q9Y4Z2
Target Species
Human
Target Name
NEUROG3
Target Full Name
Neurogenin-3
Target Function
Acts as a transcriptional regulator. Together with NKX2-2, initiates transcriptional activation of NEUROD1. Involved in neurogenesis. Also required for the specification of a common precursor of the 4 pancreatic endocrine cell types.
Target Involvement
Diarrhea 4, malabsorptive, congenital (DIAR4)
Target Subcellular Location
Nucleus.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
ATH4B; Atoh5; bHLHa7; Class A basic helix-loop-helix protein 7; Math4B; NEUROG3; Neurogenin-3; Neurogenin3; NGN-3; ngn3; NGN3_HUMAN; OTTHUMP00000019730; Protein atonal homolog 5
Target Background
The protein encoded by this gene is a basic helix-loop-helix (bHLH) transcription factor involved in neurogenesis. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of congenital malabsorptive diarrhea 4 (DIAR4).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
