Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NEXN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 516-675 of human NEXN (NP_653174.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NEXN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 516-675 of human NEXN (NP_653174.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03454A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NEXN |
| Target Synonyms | CMH20; NELIN; NEXN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse testis, Rat spleen, Rat testis, SGC-7901 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 516-675 of human NEXN (NP_653174.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RFEQMAKAREEEEQRRIEEQKLLRMQFEQREIDAALQKKREEEEEEEGSIMNGSTAEDEEQTRSGAPWFKKPLKNTSVVDSEPVRFTVKVTGEPKPEITWWFEGEILQDGEDYQYIERGETYCLYLPETFPEDGGEYMCKAVNNKGSAASTCILTIESKN | Uniprot ID | Q0ZGT2 |
Uniprot Id
Q0ZGT2
Target Species
Human
Target Name
NEXN
Target Full Name
Nexilin
Target Function
Involved in regulating cell migration through association with the actin cytoskeleton. Has an essential role in the maintenance of Z line and sarcomere integrity.
Target Involvement
Cardiomyopathy, dilated 1CC (CMD1CC); Cardiomyopathy, familial hypertrophic 20 (CMH20)
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell junction, adherens junction. Cytoplasm, myofibril, sarcomere, Z line.
Target Tissue Specificity
Abundantly expressed in heart and skeletal muscle, and at lower levels in placenta, lung, liver and pancreas. Also expressed in HeLaS3 and MOLT-4 cell lines.
Target Synonyms
1110046H09Rik; AA553326; F-actin binding protein ; F-actin-binding protein; MGC104234; MGC138865; MGC138866; Nelin; Nexilin; Nexn; NEXN_HUMAN; nF actin binding protein; OTTHUMP00000038336
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
