Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NFAM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 186-270 of human NFAM1 (NP_666017.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NFAM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 186-270 of human NFAM1 (NP_666017.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04960A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NFAM1 |
| Target Synonyms | CNAIP; NFAM1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 186-270 of human NFAM1 (NP_666017.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WNKKRMRGPGKDPTRKCPDPRSASSPKQHPSESVYTALQRRETEVYACIENEDGSSPTAKQSPLSQERPHRFEDDGELNLVYENL | Uniprot ID | Q8NET5 |
Uniprot Id
Q8NET5
Target Species
Human
Target Name
NFAM1
Target Full Name
NFAT activation molecule 1
Target Function
May function in immune system as a receptor which activates via the calcineurin/NFAT-signaling pathway the downstream cytokine gene promoters. Activates the transcription of IL-13 and TNF-alpha promoters. May be involved in the regulation of B-cell, but not T-cell, development. Overexpression activates downstream effectors without ligand binding or antibody cross-linking.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Highly expressed in neutrophils, primary monocytes, mast cells, monocytic cell lines and lymphocytes. Also expressed in spleen B and T-cells, and lung. Expressed at low level in non-immune tissue.
Target Synonyms
NFAM1; CNAIPNFAT activation molecule 1; Calcineurin/NFAT-activating ITAM-containing protein; NFAT-activating protein with ITAM motif 1
Target Background
The protein encoded by this gene is a type I membrane receptor that activates cytokine gene promoters such as the IL-13 and TNF-alpha promoters. The encoded protein contains an immunoreceptor tyrosine-based activation motif (ITAM) and is thought to regulate the signaling and development of B-cells.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
