-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NFAT2 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 595-694 of human NFAT2(NP_001265598.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NFAT2 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 595-694 of human NFAT2(NP_001265598.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00823A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NFAT2 |
| Target Synonyms | NFATC1; NF-ATC; NF-ATc1.2; NFAT2; NFATc; nuclear factor of activated T-cells 1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Daudi, Mouse spleen, Mouse thymus, Ramos | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 595-694 of human NFAT2(NP_001265598.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLP | Uniprot ID | O95644 |
Uniprot Id
O95644
Target Species
Human
Target Name
NFATC1
Target Full Name
Nuclear factor of activated T-cells, cytoplasmic 1
Target Function
Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 or IL-4 gene transcription. Also controls gene expression in embryonic cardiac cells. Could regulate not only the activation and proliferation but also the differentiation and programmed death of T-lymphocytes as well as lymphoid and non-lymphoid cells. Required for osteoclastogenesis and regulates many genes important for osteoclast differentiation and function.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Tissue Specificity
Expressed in thymus, peripheral leukocytes as T-cells and spleen. Isoforms A are preferentially expressed in effector T-cells (thymus and peripheral leukocytes) whereas isoforms B and isoforms C are preferentially expressed in naive T-cells (spleen). Isof
Target Synonyms
cytoplasmic 1; MGC138448; NF ATc; NF ATc1; NF-ATc; NF-ATc1; NF-ATc1.2; NFAC1_HUMAN; NFAT 2; NFAT transcription complex cytosolic component; NFATC 1; NFATc; NFATc1; Nuclear factor of activated T cells cytoplasmic 1; Nuclear factor of activated T cells cytoplasmic calcineurin dependent 1; Nuclear factor of activated T cells cytosolic component 1 ; nuclear factor of activated T-cells 'c'; Nuclear factor of activated T-cells
Target Background
The product of this gene is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Different isoforms of this protein may regulate inducible expression of different cytokine genes.
Notification