-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NFATC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 560-710 of human NFATC4 (NP_004545.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NFATC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 560-710 of human NFATC4 (NP_004545.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06914A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NFATC4 |
| Target Synonyms | NFAT3; NF-AT3; NF-ATC4; NFATC4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-549, HepG2, Mouse brain, Mouse lung, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 560-710 of human NFATC4 (NP_004545.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QGGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRGGEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFRFLPVICKEEPLPDSSLRGFPSASATPFG | Uniprot ID | Q14934 |
Uniprot Id
Q14934
Target Species
Human
Target Name
NFATC4
Target Full Name
Nuclear factor of activated T-cells, cytoplasmic 4
Target Function
Ca(2+)-regulated transcription factor that is involved in several processes, including the development and function of the immune, cardiovascular, musculoskeletal, and nervous systems. Involved in T-cell activation, stimulating the transcription of cytokine genes, including that of IL2 and IL4. Along with NFATC3, involved in embryonic heart development. Involved in mitochondrial energy metabolism required for cardiac morphogenesis and function. Transactivates many genes involved in the cardiovascular system, including AGTR2, NPPB/BNP (in synergy with GATA4), NPPA/ANP/ANF and MYH7/beta-MHC. Involved in the regulation of adult hippocampal neurogenesis. Involved in BDNF-driven pro-survival signaling in hippocampal adult-born neurons. Involved in the formation of long-term spatial memory and long-term potentiation. In cochlear nucleus neurons, may play a role in deafferentation-induced apoptosis during the developmental critical period, when auditory neurons depend on afferent input for survival. Binds to and activates the BACE1/Beta-secretase 1 promoter, hence may regulate the proteolytic processing of the amyloid precursor protein (APP). Plays a role in adipocyte differentiation. May be involved in myoblast differentiation into myotubes. Binds the consensus DNA sequence 5'-GGAAAAT-3' (Probable). In the presence of CREBBP, activates TNF transcription. Binds to PPARG gene promoter and regulates its activity. Binds to PPARG and REG3G gene promoters.
Target Subcellular Location
Cytoplasm, cytosol. Nucleus.
Target Tissue Specificity
Widely expressed, with high levels in placenta, lung, kidney, testis and ovary. Weakly expressed in spleen and thymus. In the hippocampus, expressed in the granular layer of the dentate gyrus, in the pyramidal neurons of CA3 region, and in the hippocampal
Target Synonyms
cytoplasmic 4; NF ATc4; NF-AT3; NF-ATc4; NFAC4_HUMAN; NFAT3; NFATc4; Nuclear factor of activated T cells cytoplasmic 4; Nuclear factor of activated T cells cytoplasmic calcineurin dependent 4; Nuclear factor of activated T-cells; T cell transcription factor NFAT3; T-cell transcription factor NFAT3
Target Background
This gene encodes a member of the nuclear factor of activated T cells (NFAT) protein family. The encoded protein is part of a DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor stimulation and an inducible nuclear component. NFAT proteins are activated by the calmodulin-dependent phosphatase, calcineurin. The encoded protein plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of interleukin-2 and interleukin-4. Alternative splicing results in multiple transcript variants.
Notification