Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NFIX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-260 of human NFIX (NP_002492.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NFIX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-260 of human NFIX (NP_002492.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00993A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NFIX |
| Target Synonyms | CTF; NF1A; MALNS; NF1-X; MRSHSS; NF-I/X; SOTOS2; NFIX | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-260 of human NFIX (NP_002492.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AYFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPVATASGPNFSLADLESPSYYNINQVT | Uniprot ID | Q14938 |
Uniprot Id
Q14938
Target Species
Human
Target Name
NFIX
Target Full Name
Nuclear factor 1 X-type
Target Function
Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.
Target Involvement
Sotos syndrome 2 (SOTOS2); Marshall-Smith syndrome (MRSHSS)
Target Subcellular Location
Nucleus.
Target Protein Families
CTF/NF-I family
Target Tissue Specificity
Widely expressed.
Target Synonyms
CCAAT box binding transcription factor; CCAAT-box-binding transcription factor; CTF; NF-I/X; NF1-X; NF1A; NF1X; NFI X; NFI-X; NFI/X; NFIX; NFIX_HUMAN; Nuclear factor 1 X type; Nuclear factor 1 X-type; Nuclear factor 1/X; Nuclear factor I/X; TGGCA binding protein; TGGCA-binding protein
Target Background
The protein encoded by this gene is a transcription factor that binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3 in viral and cellular promoters. The encoded protein can also stimulate adenovirus replication in vitro. Three transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
