-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NFYC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-120 of human NFYC (NP_055038.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NFYC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-120 of human NFYC (NP_055038.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00909A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NFYC |
| Target Synonyms | HSM; CBFC; HAP5; CBF-C; NF-YC; H1TF2A; NFYC | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 27-120 of human NFYC (NP_055038.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR | Uniprot ID | Q13952 |
Uniprot Id
Q13952
Target Species
Human
Target Name
NFYC
Target Full Name
Nuclear transcription factor Y subunit gamma
Target Function
Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors.
Target Subcellular Location
Nucleus.
Target Protein Families
NFYC/HAP5 subunit family
Target Synonyms
CAAT box DNA binding protein subunit C; CAAT box DNA-binding protein subunit C; CBF C; CBFC; CCAAT binding factor subunit C; CCAAT transcription binding factor subunit gamma; DKFZp667G242; FLJ45775; H1TF2A; HAP5; histone H1 transcription factor large subunit 2A; HSM; NF-YC; NFYC; NFYC_HUMAN; Nuclear transcription factor Y gamma; Nuclear transcription factor Y subunit C; Nuclear transcription factor Y subunit gamma; OTTHUMP00000009207; OTTHUMP00000009208; OTTHUMP00000009209; OTTHUMP00000009210; OTTHUMP00000009211; OTTHUMP00000009212; OTTHUMP00000009213; OTTHUMP00000009215; OTTHUMP00000009217; OTTHUMP00000231028; Transactivator HSM 1/2; transactivator HSM-1; Transactivator HSM-1/2
Target Background
This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification