-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NGF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 122-241 of human NGF (NP_002497.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NGF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 122-241 of human NGF (NP_002497.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06551A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NGF |
| Target Synonyms | NGFB; HSAN5; Beta-NGF; NGF | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 122-241 of human NGF (NP_002497.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA | Uniprot ID | P01138 |
Uniprot Id
P01138
Target Species
Human
Target Name
NGF
Target Full Name
Beta-nerve growth factor
Target Function
Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades to regulate neuronal proliferation, differentiation and survival (Probable). The immature NGF precursor (proNGF) functions as ligand for the heterodimeric receptor formed by SORCS2 and NGFR, and activates cellular signaling cascades that lead to inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton and neuronal growth cone collapse. In contrast to mature NGF, the precursor form (proNGF) promotes neuronal apoptosis (in vitro). Inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI. Binds lysophosphatidylinositol and lysophosphatidylserine between the two chains of the homodimer. The lipid-bound form promotes histamine relase from mast cells, contrary to the lipid-free form.
Target Involvement
Neuropathy, hereditary sensory and autonomic, 5 (HSAN5)
Target Subcellular Location
Secreted. Endosome lumen.
Target Protein Families
NGF-beta family
Target Research Area
Neuroscience
Target Synonyms
Beta nerve growth factor; Beta NGF; Beta-nerve growth factor; Beta-NGF; HSAN5; MGC161426; MGC161428; Nerve growth factor (beta polypeptide); Nerve growth factor; Nerve growth factor beta; Nerve growth factor beta polypeptide; Nerve growth factor beta subunit; NGF; NGF_HUMAN; NGFB; NID67
Target Background
This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis.
Notification