Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NIP7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human NIP7 (NP_057185.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NIP7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human NIP7 (NP_057185.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00444A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NIP7 |
| Target Synonyms | KD93; CGI-37; HSPC031; NIP7 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A375, HL-60, HT-1080, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human NIP7 (NP_057185.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT | Uniprot ID | Q9Y221 |
Uniprot Id
Q9Y221
Target Species
Human
Target Name
NIP7
Target Full Name
60S ribosome subunit biogenesis protein NIP7 homolog
Target Function
Required for proper 34S pre-rRNA processing and 60S ribosome subunit assembly.
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
NIP7 family
Target Tissue Specificity
Expressed in hematopoietic stem/progenitor cells.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
60S ribosome subunit biogenesis protein NIP7 homolog; CGI 37; CGI37; FLJ10296; HSPC031; HSPC180; KD93; NIP 7; NIP7; NIP7 nucleolar pre rRNA processing protein; NIP7_HUMAN; Nuclear import 7; Nuclear import 7 homolog (S. cerevisiae); Nuclear import 7 homolog; OK/SW cl.76; OK/SW cl.78; OTTHUMP00000174889
Target Background
Enables RNA binding activity. Predicted to be involved in ribosomal large subunit biogenesis. Located in cytosol; nucleolus; and nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
