-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NKX2-1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NKX2-1 (P43699) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NKX2-1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NKX2-1 (P43699) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16489A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NKX2-1 |
| Target Synonyms | BCH; BHC; NK-2; TEBP; TTF1; NKX2A; NMTC1; T/EBP; TITF1; TTF-1; NKX2.1; NKX2-1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HepG2, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NKX2-1 (P43699). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPY | Uniprot ID | P43699 |
Uniprot Id
P43699
Target Species
Human
Target Name
NKX2-1
Target Full Name
Homeobox protein Nkx-2.1
Target Function
Transcription factor that binds and activates the promoter of thyroid specific genes such as thyroglobulin, thyroperoxidase, and thyrotropin receptor. Crucial in the maintenance of the thyroid differentiation phenotype. May play a role in lung development and surfactant homeostasis. Forms a regulatory loop with GRHL2 that coordinates lung epithelial cell morphogenesis and differentiation. Activates the transcription of GNRHR and plays a role in enhancing the circadian oscillation of its gene expression. Represses the transcription of the circadian transcriptional repressor NR1D1.
Target Involvement
Chorea, hereditary benign (BHC); Choreoathetosis and congenital hypothyroidism with or without pulmonary dysfunction (CAHTP); Thyroid cancer, non-medullary, 1 (NMTC1)
Target Subcellular Location
Nucleus.
Target Protein Families
NK-2 homeobox family
Target Tissue Specificity
Thyroid and lung.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
AV026640; BCH; Benign chorea ; BHC; Homeobox protein NK 2 homolog A; Homeobox protein NK-2 homolog A; Homeobox protein Nkx 2.1; Homeobox protein Nkx-2.1; Homeobox protein Nkx2.1; NK 2; NK 2 homolog A; NK2; NK2 homeobox 1; NK2; drosophila; homolog of; A; NK2.1; mouse; homolog of; Nkx 2 1; NKX 2.1; NKX 2A; NKX2 1; Nkx2-1; NKX2.1; NKX21_HUMAN; NKX2A; T EBP; T/EBP; TEBP; Thyroid nuclear factor 1; Thyroid nuclear factor; Thyroid specific enhancer binding protein; Thyroid transcription factor 1; Tin man; Tinman; TITF 1; TITF1; TTF 1; TTF-1; TTF1
Target Background
This gene encodes a protein initially identified as a thyroid-specific transcription factor. The encoded protein binds to the thyroglobulin promoter and regulates the expression of thyroid-specific genes but has also been shown to regulate the expression of genes involved in morphogenesis. Mutations and deletions in this gene are associated with benign hereditary chorea, choreoathetosis, congenital hypothyroidism, and neonatal respiratory distress, and may be associated with thyroid cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares the symbol/alias 'TTF1' with another gene, transcription termination factor 1, which plays a role in ribosomal gene transcription.
Notification