Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NKX2-5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-137 of human NKX2-5 (NP_004378.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NKX2-5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-137 of human NKX2-5 (NP_004378.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of various lysates, using NKX2-5 Rabbit pAb at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
| Cat.No | ADA-07940A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | nkx2.5 |
| Target Synonyms | CSX; CSX1; VSD3; CHNG5; HLHS2; NKX2E; NKX2.5; NKX4-1; NKX2-5 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-137 of human NKX2-5 (NP_004378.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARR | Uniprot ID | P52952 |
Uniprot Id
P52952
Target Species
Human
Target Name
NKX2-5
Target Full Name
Homeobox protein Nkx-2.5
Target Function
Transcription factor required for the development of the heart and the spleen. During heart development, acts as a transcriptional activator of NPPA/ANF in cooperation with GATA4. May cooperate with TBX2 to negatively modulate expression of NPPA/ANF in the atrioventricular canal. Binds to the core DNA motif of NPPA promoter. Together with PBX1, required for spleen development through a mechanism that involves CDKN2B repression.
Target Involvement
Atrial septal defect 7, with or without atrioventricular conduction defects (ASD7); Tetralogy of Fallot (TOF); Conotruncal heart malformations (CTHM); Hypothyroidism, congenital, non-goitrous, 5 (CHNG5); Ventricular septal defect 3 (VSD3); Hypoplastic left heart syndrome 2 (HLHS2)
Target Subcellular Location
Nucleus.
Target Protein Families
NK-2 homeobox family
Target Tissue Specificity
Expressed only in the heart.
Target Synonyms
NKX2.5; mouse; homolog of; Cardiac-specific homeobox 1; Cardiac-specific homeobox; CHNG5; CSX; CSX1; FLJ52202; FLJ97166; FLJ97195; FLJ97197; FLJ99536; HLHS2; Homeobox protein CSX; Homeobox protein NK-2 homolog E; Homeobox protein Nkx 2.5; Homeobox protein Nkx-2.5; NK2 homeobox 5; NK2 transcription factor related locus 5; NK2 transcription factor related; locus 5 (Drosophila); NK2; Drosophila; homolog of; E; NKX2-5; NKX2.5; NKX25_HUMAN; Nkx2E; NKX4-1; Tinman paralog; VSD3
Target Background
This gene encodes a homeobox-containing transcription factor. This transcription factor functions in heart formation and development. Mutations in this gene cause atrial septal defect with atrioventricular conduction defect, and also tetralogy of Fallot, which are both heart malformation diseases. Mutations in this gene can also cause congenital hypothyroidism non-goitrous type 5, a non-autoimmune condition. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
