-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NKX3.1 was raised in Rabbit using the recombinant fusion protein containing a sequence within amino acids 1-80 of human NKX3.1 (NP_006158.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NKX3.1 was raised in Rabbit using the recombinant fusion protein containing a sequence within amino acids 1-80 of human NKX3.1 (NP_006158.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07509A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NKX3-1 |
| Target Synonyms | NKX3; BAPX2; NKX3A; NKX3.1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, DU-145, Jurkat, LNCaP | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence within amino acids 1-80 of human NKX3.1 (NP_006158.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGP | Uniprot ID | Q99801 |
Uniprot Id
Q99801
Target Species
Human
Target Name
NKX3-1
Target Full Name
Homeobox protein Nkx-3.1
Target Function
Transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. Plays an important role in normal prostate development, regulating proliferation of glandular epithelium and in the formation of ducts in prostate. Acts as a tumor suppressor controlling prostate carcinogenesis, as shown by the ability to inhibit proliferation and invasion activities of PC-3 prostate cancer cells.
Target Subcellular Location
Nucleus.
Target Protein Families
NK-3 homeobox family
Target Tissue Specificity
Highly expressed in the prostate and, at a lower level, in the testis.
Target Synonyms
BAPX 2; BAPX2; Homeobox protein NK-3 homolog A; Homeobox protein Nkx 3.1; Homeobox protein Nkx-3.1; Homeobox protein Nkx3.1; NK homeobox (Drosophila) family 3 A; NK homeobox family 3 A; NK homeobox, family 3, member A; NK3 homeobox 1; NK3 transcription factor homolog A; NK3 transcription factor related locus 1; NKX 3; Nkx 3.1; NKX 3A; NKX3 1; NKX3; Nkx3-1; NKX3.1; Nkx3.1, mouse, homolog of; NKX31_HUMAN; NKX3A
Target Background
This gene encodes a homeobox-containing transcription factor. This transcription factor functions as a negative regulator of epithelial cell growth in prostate tissue. Aberrant expression of this gene is associated with prostate tumor progression. Alternate splicing results in multiple transcript variants of this gene.
Notification