-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NLGN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human NLGN1 (NP_055747.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NLGN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human NLGN1 (NP_055747.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00560A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NLGN1 |
| Target Synonyms | NL1; NLGN1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human NLGN1 (NP_055747.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YGNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTAL | Uniprot ID | Q8N2Q7 |
Uniprot Id
Q8N2Q7
Target Species
Human
Target Name
NLGN1
Target Full Name
Neuroligin-1
Target Function
Cell surface protein involved in cell-cell-interactions via its interactions with neurexin family members. Plays a role in synapse function and synaptic signal transmission, and probably mediates its effects by recruiting and clustering other synaptic proteins. May promote the initial formation of synapses, but is not essential for this. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Required to maintain wakefulness quality and normal synchrony of cerebral cortex activity during wakefulness and sleep. The protein is involved in nervous system development.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction, synapse, postsynaptic density. Cell junction, synapse, synaptic cleft. Cell junction, synapse, synaptic cell membrane.
Target Protein Families
Type-B carboxylesterase/lipase family
Target Tissue Specificity
Expressed in the blood vessel walls (at protein level). Highly expressed in brain through prenatal stages, and at lower levels in pancreas islet beta cells.
Target Synonyms
NLG 1; KIAA1070; MGC45115; Neuroligin-1; NL1; NLG1; Nlgn1; NLGN1_HUMAN
Target Background
This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses.
Notification