-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NLGN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human NLGN3 (Q9NZ94) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NLGN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human NLGN3 (Q9NZ94) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01410A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NLGN3 |
| Target Synonyms | HNL3; NLGN3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Mouse brain, Mouse liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human NLGN3 (Q9NZ94). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MWLRLGPPSLSLSPKPTVGRSLCLTLWFLSLALRASTQAPAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKICRKGGSGAKKQGEDLADNDGDEDEDIRDSGAK | Uniprot ID | Q9NZ94 |
Uniprot Id
Q9NZ94
Target Species
Human
Target Name
NLGN3
Target Full Name
Neuroligin-3
Target Function
Cell surface protein involved in cell-cell-interactions via its interactions with neurexin family members. Plays a role in synapse function and synaptic signal transmission, and may mediate its effects by clustering other synaptic proteins. May promote the initial formation of synapses, but is not essential for this. May also play a role in glia-glia or glia-neuron interactions in the developing peripheral nervous system.
Target Involvement
Autism, X-linked 1 (AUTSX1); Asperger syndrome, X-linked, 1 (ASPGX1)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction, synapse.
Target Protein Families
Type-B carboxylesterase/lipase family
Target Tissue Specificity
Expressed in the blood vessel walls (at protein level). Detected in throughout the brain and in spinal cord. Detected in brain, and at lower levels in pancreas islet beta cells.
Target Synonyms
Gliotactin homolog; HNL3; Neuroligin-3; Nlgn3; NLGN3_HUMAN
Target Background
This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. Mutations in this gene may be associated with autism and Asperger syndrome. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Notification