Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NLGN4Y was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 122-256 of human NLGN4Y (NP_001157710.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against NLGN4Y was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 122-256 of human NLGN4Y (NP_001157710.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09745A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NLGN4Y |
| Target Synonyms | HNL4Y; NLGN4Y | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, A-549, Mouse brain, Mouse testis, Rat testis, U-251MG, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 122-256 of human NLGN4Y (NP_001157710.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DMLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEARLCGSSKMFNYFKSPFTNLINFF | Uniprot ID | Q8NFZ3 |
Uniprot Id
Q8NFZ3
Target Species
Human
Target Name
NLGN4Y
Target Full Name
Neuroligin-4, Y-linked
Target Function
Putative neuronal cell surface protein involved in cell-cell-interactions.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction, synapse, postsynaptic density membrane.
Target Protein Families
Type-B carboxylesterase/lipase family
Target Tissue Specificity
Expressed in fetal and adult brain, prostate and testis.
Target Synonyms
ASPGX2; AUTSX2; HGNC:14287; HLNX; HNLX; KIAA0951; KIAA1260; MGC22376; Neuroligin 4 X linked ; Neuroligin 4, Y linked; Neuroligin X; Neuroligin Y; Neuroligin-4; NLGN; NLGN4; NLGN4X; NLGN4Y; NLGNY_HUMAN; Y-linked
Target Background
This gene encodes a type I membrane protein that belongs to the family of neuroligins, which are cell adhesion molecules present at the postsynaptic side of the synapse, and may be essential for the formation of functional synapses. Alternatively spliced transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
