-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NLRC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 85-170 of human NLRC4 (NP_001186067.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NLRC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 85-170 of human NLRC4 (NP_001186067.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12886A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NLRC4 |
| Target Synonyms | CLAN; IPAF; AIFEC; CLAN1; CLANA; CLANB; CLANC; CLAND; FCAS4; CARD12; CLR2.1; NLRC4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse small intestine | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 85-170 of human NLRC4 (NP_001186067.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NGQSLFHQTSEGDLDDLAQDLKDLYHTPSFLNFYPLGEDIDIIFNLKSTFTEPVLWRKDQHHHRVEQLTLNGLLQALQSPCIIEGE | Uniprot ID | Q9NPP4 |
Uniprot Id
Q9NPP4
Target Species
Human
Target Name
NLRC4
Target Full Name
NLR family CARD domain-containing protein 4
Target Function
Key component of inflammasomes that indirectly senses specific proteins from pathogenic bacteria and fungi and responds by assembling an inflammasome complex that promotes caspase-1 activation, cytokine production and macrophage pyroptosis. The NLRC4 inflammasome is activated as part of the innate immune response to a range of intracellular bacteria.
Target Involvement
Autoinflammation with infantile enterocolitis (AIFEC); Familial cold autoinflammatory syndrome 4 (FCAS4)
Target Subcellular Location
Cytoplasm. Cytoplasm, cytosol. Inflammasome.
Target Tissue Specificity
Isoform 2 is expressed ubiquitously, although highly expressed in lung and spleen. Isoform 1 is highly expressed in lung, followed by leukocytes especially monocytes, lymph node, colon, brain, prostate, placenta, spleen, bone marrow and fetal liver. Isofo
Target Synonyms
and NACHT-containing protein; CARD 12; CARD; CARD LRR and NACHT containing protein 1; CARD LRR and NACHT containing protein; CARD12; Caspase recruitment domain containing protein 12; Caspase recruitment domain family member 12; Caspase recruitment domain-containing protein 12; CLAN 1; CLAN A; CLAN; CLAN B; CLAN C; CLAN D; Clan protein; CLAN1; CLANA; CLANB; CLANC; CLAND; CLR 2.1; CLR2.1; ICE protease activating factor; Ice protease-activating factor; Ipaf; LRR; NLR family CARD domain containing 4; NLR family CARD domain-containing protein 4; NLRC 4; NLRC4; NLRC4_HUMAN; NOD like receptor C4; Nucleotide binding oligomerization domain leucine rich repeat and CARD domain containing 4; UNQ6189/PRO20215
Target Background
This gene encodes a member of the caspase recruitment domain-containing NLR family. Family members play essential roles in innate immune response to a wide range of pathogenic organisms, tissue damage and other cellular stresses. Mutations in this gene result in autoinflammation with infantile enterocolitis. Alternative splicing results in multiple transcript variants.
Notification