Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NLRP11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 420-600 of human NLRP11 (NP_659444.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NLRP11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 420-600 of human NLRP11 (NP_659444.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09264A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NLRP11 |
| Target Synonyms | NOD17; PAN10; NALP11; PYPAF6; PYPAF7; CLR19.6; NLRP11 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 420-600 of human NLRP11 (NP_659444.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VGFTEADVSVLQAANILLPSNTHKDRYKFIHLNVQEFCTAIAFLMAVPNYLIPSGSREYKEKREQYSDFNQVFTFIFGLLNANRRKILETSFGYQLPMVDSFKWYSVGYMKHLDRDPEKLTHHMPLFYCLYENREEEFVKTIVDALMEVTVYLQSDKDMMVSLYCLDYCCHLRTLKLSVQR | Uniprot ID | P59045 |
Uniprot Id
P59045
Target Species
Human
Target Name
NLRP11
Target Full Name
NACHT, LRR and PYD domains-containing protein 11
Target Function
Involved in inflammation.
Target Protein Families
NLRP family
Target Synonyms
CLR19.6; FLJ26273; NACHT leucine rich repeat and PYD containing 11; NACHT LRR and PYD domains containing protein 11; NACHT, LRR and PYD domains-containing protein 11; NAL11_HUMAN; NALP11; NLR family pyrin domain containing 11; NLRP11; NOD17; Nucleotide binding oligomerization domain protein 17; Nucleotide-binding oligomerization domain protein 17; Nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 11; PAAD and NACHT containing protein 10B; PAAD and NACHT domain containing protein 10; PAAD-and NACHT domain-containing protein 10; PAN10; PYPAF6; PYPAF7; PYRIN containing APAF1 like protein 6; PYRIN-containing APAF1-like protein 6
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
