-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NLRP12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 862-1061 of human NLRP12 (NP_653288.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NLRP12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 862-1061 of human NLRP12 (NP_653288.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05590A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NLRP12 |
| Target Synonyms | RNO; PAN6; RNO2; FCAS2; NALP12; PYPAF7; CLR19.3; NLRP12 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 862-1061 of human NLRP12 (NP_653288.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLGVLLLCEGLRHPTCKLQTLRLGICRLGSAACEGLSVVLQANHNLRELDLSFNDLGDWGLWLLAEGLQHPACRLQKLWLDSCGLTAKACENLYFTLGINQTLTDLYLTNNALGDTGVRLLCKRLSHPGCKLRVLWLFGMDLNKMTHSRLAALRVTKPYLDIGC | Uniprot ID | P59046 |
Uniprot Id
P59046
Target Species
Human
Target Name
NLRP12
Target Full Name
NACHT, LRR and PYD domains-containing protein 12
Target Function
Plays an essential role as an potent mitigator of inflammation. Primarily expressed in dendritic cells and macrophages, inhibits both canonical and non-canonical NF-kappa-B and ERK activation pathways. Functions as a negative regulator of NOD2 by targeting it to degradation via the proteasome pathway. In turn, promotes bacterial tolerance. Inhibits also the DDX58-mediated immune signaling against RNA viruses by reducing the E3 ubiquitin ligase TRIM25-mediated 'Lys-63'-linked DDX58 activation but enhancing the E3 ubiquitin ligase RNF125-mediated 'Lys-48'-linked DDX58 degradation. Acts also as a negative regulator of inflammatory response to mitigate obesity and obesity-associated diseases in adipose tissue.
Target Involvement
Familial cold autoinflammatory syndrome 2 (FCAS2)
Target Subcellular Location
Cytoplasm.
Target Protein Families
NLRP family
Target Tissue Specificity
Detected only in peripheral blood leukocytes, predominantly in eosinophils and granulocytes, and at lower levels in monocytes.
Target Synonyms
CLR19.3; FCAS2; Monarch 1; Monarch-1; NACHT, leucine rich repeat and PYD containing 12; NACHT, LRR and PYD containing protein 12; NACHT, LRR and PYD domains-containing protein 12; NAL12_HUMAN; NLR family, pyrin domain containing 12; NLRP12; Nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 12; OTTHUMP00000067227; PAN6; PYPAF7; PYRIN containing APAF1 like protein 7; PYRIN-containing APAF1-like protein 7; Regulated by nitric oxide; RNO; RNO2
Target Background
This gene encodes a member of the CATERPILLER family of cytoplasmic proteins. The encoded protein, which contains an N-terminal pyrin domain, a NACHT domain, a NACHT-associated domain, and a C-terminus leucine-rich repeat region, functions as an attenuating factor of inflammation by suppressing inflammatory responses in activated monocytes. Mutations in this gene cause familial cold autoinflammatory syndrome type 2. Alternative splicing results in multiple transcript variants.
Notification