-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NME4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-187 of human NME4 (NP_005000.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NME4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-187 of human NME4 (NP_005000.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01502A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NME4 |
| Target Synonyms | NDPK-D; NM23H4; nm23-H4; NME4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, A-549, BT-474, Jurkat, Mouse stomach, NCI-H460 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-187 of human NME4 (NP_005000.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA | Uniprot ID | O00746 |
Uniprot Id
O00746
Target Species
Human
Target Name
NME4
Target Full Name
Nucleoside diphosphate kinase, mitochondrial
Target Function
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Through the catalyzed exchange of gamma-phosphate between di- and triphosphonucleosides participates in regulation of intracellular nucleotide homeostasis. Binds to anionic phospholipids, predominantly to cardiolipin; the binding inhibits its phosphotransfer activity. Acts as mitochondria-specific NDK; its association with cardiolipin-containing mitochondrial inner membrane is coupled to respiration suggesting that ADP locally regenerated in the mitochondrion innermembrane space by its activity is directly taken up via ANT ADP/ATP translocase into the matrix space to stimulate respiratory ATP regeneration. Proposed to increase GTP-loading on dynamin-related GTPase OPA1 in mitochondria. In vitro can induce liposome cross-linking suggesting that it can cross-link inner and outer membranes to form contact sites, and promotes intermembrane migration of anionic phosphoplipids. Promotes the redistribution of cardiolipin between the mitochondrial inner membrane and outer membrane which is implicated in pro-apoptotic signaling.
Target Subcellular Location
Mitochondrion intermembrane space; Peripheral membrane protein. Mitochondrion matrix.
Target Protein Families
NDK family
Target Tissue Specificity
Widely distributed. Found at very high levels in prostate, heart, liver, small intestine, and skeletal muscle tissues, and in low amounts in the brain and in blood leukocytes.
Target Research Area
Signal Transduction
Target Synonyms
metastatic inhibition factor NM23H4; mitochondrial; NDK; NDKM_HUMAN; NDP kinase; NDP kinase D; NDP kinase, mitochondrial; NDPK D; NDPKD; nm23 H4; nm23-H4; NM23D; NM23H4; Nm23M4; NME/NM23 nucleoside diphosphate kinase 4; NME4; Non metastatic cells 4 protein expressed in; Non metastatic protein 23, homolog 4; Nucleoside diphosphate kinase D; Nucleoside diphosphate kinase, mitochondrial; Nucleoside diphosphate kinase, mitochondrial
Target Background
The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).
Notification