Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NME6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 9-194 of human NME6 (NP_005784.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against NME6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 9-194 of human NME6 (NP_005784.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05674A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NME6 |
| Target Synonyms | NDK 6; NM23-H6; IPIA-ALPHA; NME6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse liver, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 9-194 of human NME6 (NP_005784.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA | Uniprot ID | O75414 |
Uniprot Id
O75414
Target Species
Human
Target Name
NME6
Target Full Name
Nucleoside diphosphate kinase 6
Target Function
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Inhibitor of p53-induced apoptosis.
Target Protein Families
NDK family
Target Tissue Specificity
Expressed at a moderately low level in many tissues. Most abundant in kidney, prostate, ovary, intestine, and spleen.
Target Synonyms
Inhibitor of p53 induced apoptosis alpha ; Inhibitor of p53-induced apoptosis-alpha; IPIA ALPHA; IPIA-alpha; NDK 6; NDK6_HUMAN; NDP kinase 6; NM23 H6 ; nm23-H6; NM23H6 ; Nme6; Nucleoside diphosphate kinase 6; OTTHUMP00000164810; OTTHUMP00000210736; OTTHUMP00000210737; OTTHUMP00000210738; OTTHUMP00000210741; OTTHUMP00000210742; OTTHUMP00000210744; OTTHUMP00000210745
Target Background
Nucleoside diphosphate (NDP) kinases (EC 2.7.4.6), such as NME6, are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates (Mehus et al., 1999 [PubMed 10453732]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
