Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NMUR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-426 of human NMUR1 (NP_006047.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NMUR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-426 of human NMUR1 (NP_006047.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06983A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NMUR1 |
| Target Synonyms | FM3; FM-3; GPC-R; GPR66; NMU1R; (FM-3); NMUR1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SGC-7901 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 360-426 of human NMUR1 (NP_006047.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQQETDPS | Uniprot ID | Q9HB89 |
Uniprot Id
Q9HB89
Target Species
Human
Target Name
NMUR1
Target Full Name
Neuromedin-U receptor 1
Target Function
Receptor for the neuromedin-U and neuromedin-S neuropeptides.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expressed in greatest abundance in peripheral organs, particularly in elements of the gastrointestinal and urogenital systems with highest levels in testes. In central nervous system structures express levels are much lower than those seen in peripheral o
Target Synonyms
NMUR1; GPR66; Neuromedin-U receptor 1; NMU-R1; G-protein coupled receptor 66; G-protein coupled receptor FM-3
Target Background
Enables neuromedin U binding activity and neuromedin U receptor activity. Involved in several processes, including activation of phospholipase C activity; chloride transport; and second-messenger-mediated signaling. Is integral component of membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
