Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NMUR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 326-415 of human NMUR2 (NP_064552.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NMUR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 326-415 of human NMUR2 (NP_064552.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03253A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NMUR2 |
| Target Synonyms | FM4; FM-4; TGR1; NMU2R; TGR-1; NMU-R2; NMUR2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse small intestine, Mouse uterus, Rat uterus, SGC-7901 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 326-415 of human NMUR2 (NP_064552.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IYNLLSRRFQAAFQNVISSFHKQWHSQHDPQLPPAQRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT | Uniprot ID | Q9GZQ4 |
Uniprot Id
Q9GZQ4
Target Species
Human
Target Name
NMUR2
Target Full Name
Neuromedin-U receptor 2
Target Function
Receptor for the neuromedin-U and neuromedin-S neuropeptides.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Predominantly expressed in the CNS, particularly in the medulla oblongata, pontine reticular formation, spinal cord, and thalamus. High level in testis whereas lower levels are present in a variety of peripheral tissues including the gastrointestinal trac
Target Synonyms
NMUR2; NMU2R; TGR1; Neuromedin-U receptor 2; NMU-R2; G-protein coupled receptor FM-4; G-protein coupled receptor TGR-1
Target Background
This gene encodes a protein from the G-protein coupled receptor 1 family. This protein is a receptor for neuromedin U, which is a neuropeptide that is widely distributed in the gut and central nervous system. This receptor plays an important role in the regulation of food intake and body weight.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
