Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NOP16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human NOP16 (NP_057475.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NOP16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human NOP16 (NP_057475.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06105A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NOP16 |
| Target Synonyms | HSPC111; HSPC185; NOP16 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, A-549, HT-29, MCF7, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human NOP16 (NP_057475.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE | Uniprot ID | Q9Y3C1 |
Uniprot Id
Q9Y3C1
Target Species
Human
Target Name
NOP16
Target Full Name
Nucleolar protein 16
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
NOP16 family
Target Synonyms
CGI 117; HBV pre S2 trans regulated protein 3; HBV pre-S2 trans-regulated protein 3; HSPC185; Hypothetical protein HSPC111; NOP16; NOP16 Gene; NOP16 nucleolar protein homolog ; NOP16 nucleolar protein homolog (yeast); NOP16_HUMAN; Nucleolar protein 16; Nucleolar protein 16 homolog ; Nucleolar protein 16 homolog (yeast); OTTHUMP00000223274; OTTHUMP00000223277
Target Background
This gene encodes a protein that is localized to the nucleolus. Expression of this gene is induced by estrogens and Myc protein and is a marker of poor patient survival in breast cancer. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
