-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NOX2/gp91phox was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human NOX2/gp91phox (P04839) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NOX2/gp91phox was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human NOX2/gp91phox (P04839) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-17062A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NOX2/gp91phox |
| Target Synonyms | CGD; CGDX; NOX2; IMD34; AMCBX2; GP91-1; GP91PHOX; p91-PHOX; GP91-PHOX; NOX2/gp91phox | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, HepG2, HL-60, Mouse lung, Mouse spleen, Raji, Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NOX2/gp91phox (P04839). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRS | Uniprot ID | P04839 |
Uniprot Id
P04839
Target Species
Human
Target Name
CYBB
Target Full Name
NADPH oxidase 2
Target Function
Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.
Target Involvement
Granulomatous disease, chronic, X-linked (CGD); Immunodeficiency 34 (IMD34)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Tissue Specificity
Detected in neutrophils (at protein level).
Target Research Area
Immunology, Cancer
Target Synonyms
AMCBX2; CGD; CGD91-phox; CY24B_HUMAN; CYBB; Cytochrome b 245; beta polypeptide; Cytochrome b(558) beta chain; Cytochrome b(558) subunit beta; Cytochrome b-245 heavy chain; Cytochrome b558 subunit beta; GP91 PHOX; gp91-1; gp91-phox; GP91PHOX; Heme-binding membrane glycoprotein gp91phox; NADPH oxidase 2; Neutrophil cytochrome b 91 kDa polypeptide; NOX2 ; p22 phagocyte B-cytochrome; P91 PHOX; p91-PHOX; Superoxide-generating NADPH oxidase heavy chain subunit
Target Background
Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cell's respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole.
Notification